PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG034142t1
Common NameTCM_034142
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family SRS
Protein Properties Length: 307aa    MW: 33907.4 Da    PI: 7.6287
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG034142t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022273.4e-70862432154
            DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.........aeaaskrkrelkskkqsa 85 
                       r+g+++CqdCGnqakkdC+h RCRtCCksrgf+C+thvkstWvpa+krrerqqqlaa+++++++++         + +++kr+r  +++ + +
  Thecc1EG034142t1  86 RQGGMNCQDCGNQAKKDCTHLRCRTCCKSRGFQCQTHVKSTWVPASKRRERQQQLAALQQQQQQQQnqqqeqqqfRGENPKRQR--ENQGAPS 176
                       7899*****************************************************998887776544443322222222222..3456667 PP

            DUF702  86 lsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                       l++t+ls ++  + le  ++P+ev+s+avfrcv+vs++dd++ee+aYqtav+i+GhvfkGiLydqG+e+
  Thecc1EG034142t1 177 LACTRLSPTT--SGLELGQYPPEVNSPAVFRCVKVSAMDDADEEFAYQTAVNIAGHVFKGILYDQGPES 243
                       7777777766..5588899************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051428.4E-6889242IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.6E-2791133IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016245.7E-26194241IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MAGFFYLGGR EGAAASKQEG EDKEENLYLY RNEEIYNKGF ELWPQYYYQQ QNVNNYSFGA  60
GPSRRTSGFN LSDESSSRSA GFTVMRQGGM NCQDCGNQAK KDCTHLRCRT CCKSRGFQCQ  120
THVKSTWVPA SKRRERQQQL AALQQQQQQQ QNQQQEQQQF RGENPKRQRE NQGAPSLACT  180
RLSPTTSGLE LGQYPPEVNS PAVFRCVKVS AMDDADEEFA YQTAVNIAGH VFKGILYDQG  240
PESRYTSGGE SSQPLDLITA ATTAAATTTT ATTSSNPGTS MLDPSLYPAP LNAFIAGTQF  300
FPPPRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6160533e-61JX616053.1 Gossypium hirsutum clone NBRI_GE60429 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017677.10.0SHI-related sequence 7, putative
SwissprotQ9LQZ51e-102SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A061FDV10.0A0A061FDV1_THECC; SHI-related sequence 7, putative
STRINGPOPTR_0002s03000.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.13e-87SHI-related sequence 5
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]